PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12547.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family B3
Protein Properties Length: 422aa    MW: 48838.5 Da    PI: 8.581
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12547.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3452e-1410101199
                 EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                 ffkv   +++l++g+l +p +f+++h +g+   s  ++l  ++g + +v+    k ++ +++++GW+eF+k  +L++  fvvF+++g+s+f  +v +f 
  KHN12547.1  10 FFKVI-LESTLRKGQLKVPTSFTRRHwQGI---SNPVILSLPNGTKRKVYW--LKDGCDVWFSNGWREFAKKLRLDVSHFVVFRYEGNSCF--NVIIFG 100
                 55655.367788889***********8555...34599999**********..9*************************************..887776 PP

                 S CS
          B3  99 k 99 
                 k
  KHN12547.1 101 K 101
                 5 PP

2B355.79.2e-18204295398
                 EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
          B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                 + l+++ ++++++l+lp +f + + +k e++ tl +   +grsW+v l+++   g+ ++++GW++F  +n+Lk+gD++ F+l+++++f++ v+++r
  KHN12547.1 204 TCLIQKTYTERDLLILPMEFSKPYLHK-EGNATLFVD--DGRSWDVGLRVNH-YGQLTFSRGWRKFSLENKLKVGDVCGFELHNSEKFSFEVSIYR 295
                 67899999*************999555.565555555..5********7555.46799***********************9988*******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.2E-198102IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-209109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.3919102IPR003340B3 DNA binding domain
CDDcd100179.96E-13999No hitNo description
PfamPF023622.3E-121099IPR003340B3 DNA binding domain
SMARTSM010198.1E-1410102IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-18196295IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-18199295IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.24202297IPR003340B3 DNA binding domain
PfamPF023626.3E-15203295IPR003340B3 DNA binding domain
CDDcd100171.45E-14206295No hitNo description
SMARTSM010192.7E-15207297IPR003340B3 DNA binding domain
SMARTSM010190.16320412IPR003340B3 DNA binding domain
CDDcd100171.12E-8340410No hitNo description
Gene3DG3DSA:2.40.330.107.9E-9346409IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-11349410IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.305356412IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MSSQGYGVHF FKVILESTLR KGQLKVPTSF TRRHWQGISN PVILSLPNGT KRKVYWLKDG  60
CDVWFSNGWR EFAKKLRLDV SHFVVFRYEG NSCFNVIIFG KSALEVEYPS SHDSNVEVEE  120
INDTDFSAKF GEDHTSKSSK KRKIIPKEEE DDDDDEPKHC KKDSGFDYSK QKNGGSSQGD  180
FKRRIKMFHE KVKEMFYAEN EHFTCLIQKT YTERDLLILP MEFSKPYLHK EGNATLFVDD  240
GRSWDVGLRV NHYGQLTFSR GWRKFSLENK LKVGDVCGFE LHNSEKFSFE VSIYRLEENS  300
STPIFKGHEQ RLSNMPSSSF RTPVTPNAST SKSKDDLCIF INEIHGRLVT LRVGCRAWQV  360
KLLCYNANSF ARFSSGWPEF ARECDLKPGD VCILKMIDVK KLVFEVSCLK GKISREENEV  420
YK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490873.11e-134PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A0B2PY970.0A0A0B2PY97_GLYSO; B3 domain-containing transcription factor VRN1
STRINGGLYMA07G19395.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140231017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49475.15e-22B3 family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]